PDB entry 1qpx

View 1qpx on RCSB PDB site
Description: crystal structures of self-capping papd chaperone homodimers
Class: chaperone
Keywords: beta barrel, immunoglobulin fold, chaperone
Deposited on 1999-05-31, released 1999-07-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: papd chaperone
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15319 (0-End)
      • sequence conflict (59)
      • mutation (107)
    Domains in SCOPe 2.01: d1qpxa1, d1qpxa2
  • Chain 'B':
    Compound: papd chaperone
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15319
      • sequence conflict (59)
      • sequence conflict (102)
      • mutation (107)
    Domains in SCOPe 2.01: d1qpxb1, d1qpxb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qpxA (A:)
    avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld
    pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvvqialctkiklfyrpaai
    ktrpnevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqt
    vksanyntpylsyindyggrpvlsficngsrcsvkkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qpxA (A:)
    avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld
    pgaksmvrlsttpdisklpqdreslfyfnlreippialctkiklfyrpaaiktrpnevwq
    dqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksanyntp
    ylsyindyggrpvlsficngsrcsvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qpxB (B:)
    avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld
    pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvvqialctkiklfyrpaai
    ktrpnevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqt
    vksanyntpylsyindyggrpvlsficngsrcsvkkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qpxB (B:)
    travfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrldpgaksm
    vrlsttpdisklpqdreslfyfnlreippvqialctkiklfyrpaaiktrpnevwqdqli
    lnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksanyntpylsy
    indyggrpvlsficngsrcsvk