PDB entry 1qpw

View 1qpw on RCSB PDB site
Description: crystal structure determination of porcine hemoglobin at 1.8a resolution
Class: oxygen transport
Keywords: x-ray study, porcine hemoglobin, artificial human blood, oxygen transport
Deposited on 1999-05-30, released 1999-06-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: poricine hemoglobin (alpha subunit)
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qpwa_
  • Chain 'B':
    Compound: poricine hemoglobin (beta subunit)
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02067 (0-145)
      • conflict (124)
    Domains in SCOPe 2.04: d1qpwb_
  • Chain 'C':
    Compound: poricine hemoglobin (alpha subunit)
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qpwc_
  • Chain 'D':
    Compound: poricine hemoglobin (beta subunit)
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02067 (0-145)
      • conflict (124)
    Domains in SCOPe 2.04: d1qpwd_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpwA (A:)
    vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
    kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
    vhasldkflanvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpwB (B:)
    vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
    kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
    dfnpdvqaafqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpwC (C:)
    vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
    kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
    vhasldkflanvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpwD (D:)
    vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
    kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
    dfnpdvqaafqkvvagvanalahkyh