PDB entry 1qpw

View 1qpw on RCSB PDB site
Description: crystal structure determination of porcine hemoglobin at 1.8a resolution
Deposited on 1999-05-30, released 1999-06-04
The last revision prior to the SCOP 1.63 freeze date was dated 2000-03-06, with a file datestamp of 2000-03-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1qpwa_
  • Chain 'B':
    Domains in SCOP 1.63: d1qpwb_
  • Chain 'C':
    Domains in SCOP 1.63: d1qpwc_
  • Chain 'D':
    Domains in SCOP 1.63: d1qpwd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpwA (A:)
    vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
    kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
    vhasldkflanvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpwB (B:)
    vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
    kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
    dfnpdvqaafqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpwC (C:)
    vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
    kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
    vhasldkflanvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpwD (D:)
    vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
    kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
    dfnpdvqaafqkvvagvanalahkyh