PDB entry 1qpv

View 1qpv on RCSB PDB site
Description: yeast cofilin
Deposited on 1999-05-29, released 1999-06-08
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-08, with a file datestamp of 1999-06-07.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.209
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qpva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpvA (A:)
    vavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpendclya
    iydfeyeingnegkrskivfftwspdtapvrskmvyasskdalrralngvstdvqgtdfs
    evsydsvlervsrg