PDB entry 1qps

View 1qps on RCSB PDB site
Description: the crystal structure of a post-reactive cognate DNA-eco ri complex at 2.50 a in the presence of mn2+ ion
Class: hydrolase/DNA
Keywords: enzyme, restriction endonculease, protein, DNA, hydrolase/DNA complex
Deposited on 1999-05-28, released 1999-06-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endonuclease ecori
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1qpsa_
  • Chain 'M':
    Compound: 5'-d(*tp*cp*gp*cp*gp*)-3'
    Species: synthetic, synthetic
  • Chain 'N':
    Compound: 5'-d(*ap*ap*tp*tp*cp*gp*cp*gp*)-3'
    Species: synthetic, synthetic
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qpsA (A:)
sqgvigifgdyakahdlavgevsklvkkalsneypqlsfryrdsikkteinealkkidpd
lggtlfvsnssikpdggivevkddygewrvvlvaeakhqgkdiinirngllvgkrgdqdl
maagnaiershkniseianfmlseshfpyvlflegsnfltenisitrpdgrvvnleynsg
ilnrldrltaanygmpinsnlcinkfvnhkdksimlqaasiytqgdgrewdskimfeimf
disttslrvlgrdlfeqltsk

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.