PDB entry 1qpr

View 1qpr on RCSB PDB site
Description: quinolinate phosphoribosyltransferase (qaprtase) from mycobacterium tuberculosis in complex with phthalate and prpcp
Class: transferase
Keywords: PRTASE, DE NOVO NAD BIOSYNTHESIS, PRPP, TRANSFERASE, PHOSPHORIBOSYLTRANSFERASE, QUINOLINIC ACID, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 1998-10-17, released 1998-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.186
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quinolinic acid phosphoribosyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpra1, d1qpra2
  • Chain 'B':
    Compound: quinolinic acid phosphoribosyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qprb1, d1qprb2
  • Chain 'C':
    Compound: quinolinic acid phosphoribosyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qprc1, d1qprc2
  • Chain 'D':
    Compound: quinolinic acid phosphoribosyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qprd1, d1qprd2
  • Chain 'E':
    Compound: quinolinic acid phosphoribosyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpre1, d1qpre2
  • Chain 'F':
    Compound: quinolinic acid phosphoribosyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qprf1, d1qprf2
  • Heterogens: MN, PHT, PPC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qprA (A:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qprB (B:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qprC (C:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qprD (D:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qprE (E:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qprF (F:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm