PDB entry 1qpq

View 1qpq on RCSB PDB site
Description: Structure of Quinolinic Acid Phosphoribosyltransferase from Mycobacterium Tuberculosis: A Potential TB Drug Target
Class: transferase
Keywords: TYPE II PRTASE, DE NOVO NAD BIOSYNTHESIS, PRPP, PHOSPHORIBOSYL TRANSFERASE, QUINOLINIC ACID, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 1998-11-20, released 1998-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.178
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quinolinate phosphoribosyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpqa1, d1qpqa2
  • Chain 'B':
    Compound: quinolinate phosphoribosyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpqb1, d1qpqb2
  • Chain 'C':
    Compound: quinolinate phosphoribosyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpqc1, d1qpqc2
  • Chain 'D':
    Compound: quinolinate phosphoribosyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpqd1, d1qpqd2
  • Chain 'E':
    Compound: quinolinate phosphoribosyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpqe1, d1qpqe2
  • Chain 'F':
    Compound: quinolinate phosphoribosyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpqf1, d1qpqf2
  • Heterogens: SO4, NTM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpqA (A:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpqB (B:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpqC (C:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpqD (D:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpqE (E:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpqF (F:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm