PDB entry 1qpo

View 1qpo on RCSB PDB site
Description: Quinolinate Phosphoribosyl Transferase (QAPRTase) Apo-Enzyme from Mycobacterium Tuberculosis
Class: transferase
Keywords: TYPE II PRTASE, DE NOVO NAD BIOSYNTHESIS, PRPP, PHOSPHORIBOSYL TRANSFERASE, QUINOLINIC ACID, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 1998-11-21, released 1998-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.176
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quinolinate acid phosphoribosyl transferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpoa1, d1qpoa2
  • Chain 'B':
    Compound: quinolinate acid phosphoribosyl transferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpob1, d1qpob2
  • Chain 'C':
    Compound: quinolinate acid phosphoribosyl transferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpoc1, d1qpoc2
  • Chain 'D':
    Compound: quinolinate acid phosphoribosyl transferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpod1, d1qpod2
  • Chain 'E':
    Compound: quinolinate acid phosphoribosyl transferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpoe1, d1qpoe2
  • Chain 'F':
    Compound: quinolinate acid phosphoribosyl transferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpof1, d1qpof2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpoA (A:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpoB (B:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpoC (C:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpoD (D:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpoE (E:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpoF (F:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm