PDB entry 1qpn

View 1qpn on RCSB PDB site
Description: Quinolinate Phosphoribosyl Transferase from Mycobacterium Tuberculosis in Complex with NCNN
Class: transferase
Keywords: TYPE II PRTASE, DE NOVO NAD BIOSYNTHESIS, PRPP, PHOSPHORIBOSYL TRANSFERASE, QUINOLINIC ACID, NAMN, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 1998-11-20, released 1998-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.185
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (quinolinate phosphoribosyl transferase)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpna1, d1qpna2
  • Chain 'B':
    Compound: protein (quinolinate phosphoribosyl transferase)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpnb1, d1qpnb2
  • Chain 'C':
    Compound: protein (quinolinate phosphoribosyl transferase)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpnc1, d1qpnc2
  • Chain 'D':
    Compound: protein (quinolinate phosphoribosyl transferase)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpnd1, d1qpnd2
  • Chain 'E':
    Compound: protein (quinolinate phosphoribosyl transferase)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpne1, d1qpne2
  • Chain 'F':
    Compound: protein (quinolinate phosphoribosyl transferase)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: NADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qpnf1, d1qpnf2
  • Heterogens: NCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpnA (A:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpnB (B:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpnC (C:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpnD (D:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpnE (E:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpnF (F:)
    glsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvall
    tlnevlgtngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatat
    aawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaags
    vvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrrdsrap
    tvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm