PDB entry 1qpm

View 1qpm on RCSB PDB site
Description: nmr structure of the mu bacteriophage repressor dna-binding domain
Deposited on 1999-05-26, released 1999-06-04
The last revision prior to the SCOP 1.67 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1qpma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qpmA (A:)
  ksiwcspqeimaadgmpgsvagvhyranvqgwtkrkkegvkggkaveydvmsmptkereq
  viahlglst