PDB entry 1qpj

View 1qpj on RCSB PDB site
Description: crystal structure of the lymphocyte-specific kinase lck in complex with staurosporine.
Class: transferase
Keywords: alpha beta fold
Deposited on 1999-05-25, released 2000-05-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lck tyrosine kinase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239
      • modified residue (163)
    Domains in SCOP 1.75: d1qpja_
  • Heterogens: SO4, STU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qpjA (A:)
    kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
    lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
    gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
    ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
    qlmrlcwkerpedrptfdylrsvledfftategqyqpqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qpjA (A:)
    dewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanlmkql
    qhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafi
    eernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtapeainyg
    tftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrl
    cwkerpedrptfdylrsvledfftat