PDB entry 1qpi

View 1qpi on RCSB PDB site
Description: crystal structure of tetracycline repressor/operator complex
Deposited on 1999-05-25, released 2000-02-28
The last revision prior to the SCOP 1.71 freeze date was dated 2000-06-14, with a file datestamp of 2000-06-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.244
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qpiA (A:)
    lnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilarh
    hdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmten
    gfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddge
    qaflhgleslirgfevqltallq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qpiA (A:)
    lnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilarh
    hdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmten
    gfslrdglyaisavshftlgavleqqehtaalenlppllrealqimdsddgeqaflhgle
    slirgfevqltallq