PDB entry 1qpi

View 1qpi on RCSB PDB site
Description: crystal structure of tetracycline repressor/operator complex
Class: transcription/DNA
Keywords: transcription regulation, repressor/operator complex, transcription/DNA complex
Deposited on 1999-05-25, released 2000-02-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.244
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (tetracycline repressor)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qpia1, d1qpia2
  • Chain 'M':
    Compound: DNA (5'-d(*cp*cp*tp*ap*tp*cp*ap*ap*tp*gp*ap*tp*ap*gp*a)-3')
    Species: synthetic, synthetic
  • Chain 'N':
    Compound: DNA (5'-d(*tp*cp*tp*ap*tp*cp*ap*tp*tp*gp*ap*tp*ap*gp*g)-3')
  • Heterogens: IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qpiA (A:)
    lnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilarh
    hdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmten
    gfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddge
    qaflhgleslirgfevqltallq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qpiA (A:)
    lnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilarh
    hdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmten
    gfslrdglyaisavshftlgavleqqehtaalenlppllrealqimdsddgeqaflhgle
    slirgfevqltallq
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.