PDB entry 1qpg

View 1qpg on RCSB PDB site
Description: 3-phosphoglycerate kinase, mutation r65q
Class: phosphotransferase (carboxyl acceptor)
Keywords: phosphotransferase (carboxyl acceptor), kinase, acetylation, glycolysis
Deposited on 1996-01-04, released 1996-06-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.185
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoglycerate kinase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00560 (0-414)
      • engineered (64)
    Domains in SCOPe 2.01: d1qpga_
  • Heterogens: MAP, 3PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpgA (A:)
    slssklsvqdldlkdkrvfirvdfnvpldgkkitsnqrivaalptikyvlehhpryvvla
    shlgqpngernekyslapvakelqsllgkdvtflndcvgpeveaavkasapgsvillenl
    ryhieeegsrkvdgqkvkaskedvqkfrhelssladvyindafgtahrahssmvgfdlpq
    raagfllekelkyfgkalenptrpflailggakvadkiqlidnlldkvdsiiigggmaft
    fkkvlenteigdsifdkagaeivpklmekakakgvevvlpvdfiiadafsadantktvtd
    kegipagwqgldngpesrklfaatvakaktivwngppgvfefekfaagtkalldevvkss
    aagntviigggdtatvakkygvtdkishvstgggaslellegkelpgvaflsekk