PDB entry 1qpc

View 1qpc on RCSB PDB site
Description: structural analysis of the lymphocyte-specific kinase lck in complex with non-selective and src family selective kinase inhibitors
Class: transferase
Keywords: alpha beta fold
Deposited on 1999-05-21, released 2000-05-24
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lck kinase
    Species: HOMO SAPIENS
    Gene: LCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239 (0-End)
      • phosphorylation (163)
    Domains in SCOP 1.75: d1qpca_
  • Heterogens: SO4, ANP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qpcA (A:)
    kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
    lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
    gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
    ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
    qlmrlcwkerpedrptfdylrsvledfftategqyqpqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qpcA (A:)
    kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
    lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
    gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
    ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
    qlmrlcwkerpedrptfdylrsvledfftate