PDB entry 1qpb

View 1qpb on RCSB PDB site
Description: pyruvate decarboyxlase from yeast (form b) complexed with pyruvamide
Class: lyase
Keywords: thiamine pyruvate, pyruvamide, lyase
Deposited on 1999-11-26, released 2000-02-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.233
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate decarboxylase (form b)
    Species: SACCHAROMYCES PASTORIANUS [TaxId:520522]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06169
      • variant (205)
      • variant (207)
      • variant (335)
      • variant (537)
    Domains in SCOPe 2.04: d1qpba1, d1qpba2, d1qpba3
  • Chain 'B':
    Compound: pyruvate decarboxylase (form b)
    Species: SACCHAROMYCES PASTORIANUS [TaxId:520522]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06169
      • variant (205)
      • variant (207)
      • variant (335)
      • variant (537)
    Domains in SCOPe 2.04: d1qpbb1, d1qpbb2, d1qpbb3
  • Heterogens: TPP, MG, PYM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qpbA (A:)
    mseitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadg
    yarikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsisaqakqlllhhtlgng
    dftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakl
    lqtpidmslkpndaesekevidtilvlikdaknpviladaccsrhdvkaetkklidltqf
    pafvtpmgkgsideqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsys
    yktknivefhsdhmkirnatfpgvqmkfvlqklltaiadaakgykpvavpartpanaavp
    astplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttg
    atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytiekli
    hgpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmievml
    pvfdapqnlveqakltaatnakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qpbA (A:)
    seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
    arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsisaqakqlllhhtlgngd
    ftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll
    qtpidmslkpndaesekevidtilvlikdaknpviladaccsrhdvkaetkklidltqfp
    afvtpmgkgsideqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsysy
    ktknivefhsdhmkirnatfpgvqmkfvlqklltaiadaakgykpvavpartpanaavpa
    stplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttga
    tlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytieklih
    gpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmievmlp
    vfdapqnlveqaklt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qpbB (B:)
    mseitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadg
    yarikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsisaqakqlllhhtlgng
    dftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakl
    lqtpidmslkpndaesekevidtilvlikdaknpviladaccsrhdvkaetkklidltqf
    pafvtpmgkgsideqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsys
    yktknivefhsdhmkirnatfpgvqmkfvlqklltaiadaakgykpvavpartpanaavp
    astplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttg
    atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytiekli
    hgpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmievml
    pvfdapqnlveqakltaatnakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qpbB (B:)
    seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
    arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsisaqakqlllhhtlgngd
    ftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll
    qtpidmslkpndaesekevidtilvlikdaknpviladaccsrhdvkaetkklidltqfp
    afvtpmgkgsideqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsysy
    ktknivefhsdhmkirnatfpgvqmkfvlqklltaiadaakgykpvavpartpanaavpa
    stplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttga
    tlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytieklih
    gpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmievmlp
    vfdapqnlveqaklt