PDB entry 1qpa

View 1qpa on RCSB PDB site
Description: lignin peroxidase isozyme lip4.65 (pi 4.65)
Deposited on 1996-10-08, released 1997-01-11
The last revision prior to the SCOP 1.61 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.162
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1qpaa_
  • Chain 'B':
    Domains in SCOP 1.61: d1qpab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpaA (A:)
    vacpdgvhtasnaaccawfpvlddiqqnlfhggqcgaeahealrmvfhdsiaispklqsq
    gkfggggadgsiitfssiettyhpnigldevvaiqkpfiakhgvtpgdfiafagavgvsn
    cpgapqmqfflgrpeatqaapdglvpepfhtidqvlarmldaggfdeietvwllsahsia
    aandvdptisglpfdstpgqfdsqffvetqlrgtafpgktgiqgtvmsplkgemrlqtdh
    lfardsrtacewqsfvnnqtklqedfqfiftalstlghdmnamidcsevipapkpvnfgp
    sffpagkthadieqacastpfptlitapgpsasvarippppspn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qpaB (B:)
    vacpdgvhtasnaaccawfpvlddiqqnlfhggqcgaeahealrmvfhdsiaispklqsq
    gkfggggadgsiitfssiettyhpnigldevvaiqkpfiakhgvtpgdfiafagavgvsn
    cpgapqmqfflgrpeatqaapdglvpepfhtidqvlarmldaggfdeietvwllsahsia
    aandvdptisglpfdstpgqfdsqffvetqlrgtafpgktgiqgtvmsplkgemrlqtdh
    lfardsrtacewqsfvnnqtklqedfqfiftalstlghdmnamidcsevipapkpvnfgp
    sffpagkthadieqacastpfptlitapgpsasvarippppspn