PDB entry 1qpa

View 1qpa on RCSB PDB site
Description: lignin peroxidase isozyme lip4.65 (pi 4.65)
Class: oxidoreductase
Keywords: oxidoreductase, lignin degradation, heme, glycoprotein
Deposited on 1996-10-08, released 1997-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.162
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lignin peroxidase
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11542 (0-343)
      • conflict (105)
      • modified residue (171)
      • conflict (283)
    Domains in SCOPe 2.07: d1qpaa_
  • Chain 'B':
    Compound: Lignin peroxidase
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11542 (0-343)
      • conflict (105)
      • modified residue (171)
      • conflict (283)
    Domains in SCOPe 2.07: d1qpab_
  • Heterogens: NAG, MAN, CA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qpaA (A:)
    vacpdgvhtasnaaccawfpvlddiqqnlfhggqcgaeahealrmvfhdsiaispklqsq
    gkfggggadgsiitfssiettyhpnigldevvaiqkpfiakhgvtpgdfiafagavgvsn
    cpgapqmqfflgrpeatqaapdglvpepfhtidqvlarmldaggfdeietvwllsahsia
    aandvdptisglpfdstpgqfdsqffvetqlrgtafpgktgiqgtvmsplkgemrlqtdh
    lfardsrtacewqsfvnnqtklqedfqfiftalstlghdmnamidcsevipapkpvnfgp
    sffpagkthadieqacastpfptlitapgpsasvarippppspnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qpaA (A:)
    vacpdgvhtasnaaccawfpvlddiqqnlfhggqcgaeahealrmvfhdsiaispklqsq
    gkfggggadgsiitfssiettyhpnigldevvaiqkpfiakhgvtpgdfiafagavgvsn
    cpgapqmqfflgrpeatqaapdglvpepfhtidqvlarmldaggfdeietvwllsahsia
    aandvdptisglpfdstpgqfdsqffvetqlrgtafpgktgiqgtvmsplkgemrlqtdh
    lfardsrtacewqsfvnnqtklqedfqfiftalstlghdmnamidcsevipapkpvnfgp
    sffpagkthadieqacastpfptlitapgpsasvarippppspn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qpaB (B:)
    vacpdgvhtasnaaccawfpvlddiqqnlfhggqcgaeahealrmvfhdsiaispklqsq
    gkfggggadgsiitfssiettyhpnigldevvaiqkpfiakhgvtpgdfiafagavgvsn
    cpgapqmqfflgrpeatqaapdglvpepfhtidqvlarmldaggfdeietvwllsahsia
    aandvdptisglpfdstpgqfdsqffvetqlrgtafpgktgiqgtvmsplkgemrlqtdh
    lfardsrtacewqsfvnnqtklqedfqfiftalstlghdmnamidcsevipapkpvnfgp
    sffpagkthadieqacastpfptlitapgpsasvarippppspnw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qpaB (B:)
    vacpdgvhtasnaaccawfpvlddiqqnlfhggqcgaeahealrmvfhdsiaispklqsq
    gkfggggadgsiitfssiettyhpnigldevvaiqkpfiakhgvtpgdfiafagavgvsn
    cpgapqmqfflgrpeatqaapdglvpepfhtidqvlarmldaggfdeietvwllsahsia
    aandvdptisglpfdstpgqfdsqffvetqlrgtafpgktgiqgtvmsplkgemrlqtdh
    lfardsrtacewqsfvnnqtklqedfqfiftalstlghdmnamidcsevipapkpvnfgp
    sffpagkthadieqacastpfptlitapgpsasvarippppspn