PDB entry 1qp2

View 1qp2 on RCSB PDB site
Description: solution structure of photosystem i accessory protein e from the cyanobacterium nostoc sp. strain pcc 8009
Deposited on 1999-05-29, released 1999-10-20
The last revision prior to the SCOP 1.55 freeze date was dated 1999-10-20, with a file datestamp of 1999-10-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1qp2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qp2A (A:)
  mvqrgskvrilrpesywfqdvgtvasvdqsgikypvivrfekvnysgintnnfaedelve
  veapkakpkk