PDB entry 1qp1

View 1qp1 on RCSB PDB site
Description:
Deposited on 1999-05-30, released 1999-06-17
The last revision prior to the SCOP 1.67 freeze date was dated 1999-06-28, with a file datestamp of 1999-06-27.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.183
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1qp1a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1qp1b_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1qp1c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qp1A (A:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qp1B (B:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qp1C (C:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik