PDB entry 1qox

View 1qox on RCSB PDB site
Description: beta-glucosidase from bacillus circulans sp. alkalophilus
Deposited on 1999-11-24, released 2000-02-27
The last revision prior to the SCOP 1.65 freeze date was dated 2000-02-27, with a file datestamp of 2000-02-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.255
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1qoxa_
  • Chain 'B':
    Domains in SCOP 1.65: d1qoxb_
  • Chain 'C':
    Domains in SCOP 1.65: d1qoxc_
  • Chain 'D':
    Domains in SCOP 1.65: d1qoxd_
  • Chain 'E':
    Domains in SCOP 1.65: d1qoxe_
  • Chain 'F':
    Domains in SCOP 1.65: d1qoxf_
  • Chain 'G':
    Domains in SCOP 1.65: d1qoxg_
  • Chain 'H':
    Domains in SCOP 1.65: d1qoxh_
  • Chain 'I':
    Domains in SCOP 1.65: d1qoxi_
  • Chain 'J':
    Domains in SCOP 1.65: d1qoxj_
  • Chain 'K':
    Domains in SCOP 1.65: d1qoxk_
  • Chain 'L':
    Domains in SCOP 1.65: d1qoxl_
  • Chain 'M':
    Domains in SCOP 1.65: d1qoxm_
  • Chain 'N':
    Domains in SCOP 1.65: d1qoxn_
  • Chain 'O':
    Domains in SCOP 1.65: d1qoxo_
  • Chain 'P':
    Domains in SCOP 1.65: d1qoxp_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoxA (A:)
    sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
    eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
    wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
    pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
    vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
    rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
    dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
    hvdydtlvrtpkdsfywykgvisrgwldl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoxB (B:)
    sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
    eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
    wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
    pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
    vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
    rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
    dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
    hvdydtlvrtpkdsfywykgvisrgwldl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoxC (C:)
    sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
    eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
    wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
    pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
    vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
    rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
    dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
    hvdydtlvrtpkdsfywykgvisrgwldl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoxD (D:)
    sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
    eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
    wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
    pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
    vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
    rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
    dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
    hvdydtlvrtpkdsfywykgvisrgwldl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoxE (E:)
    sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
    eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
    wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
    pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
    vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
    rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
    dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
    hvdydtlvrtpkdsfywykgvisrgwldl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoxF (F:)
    sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
    eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
    wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
    pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
    vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
    rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
    dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
    hvdydtlvrtpkdsfywykgvisrgwldl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoxG (G:)
    sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
    eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
    wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
    pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
    vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
    rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
    dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
    hvdydtlvrtpkdsfywykgvisrgwldl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoxH (H:)
    sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
    eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
    wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
    pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
    vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
    rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
    dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
    hvdydtlvrtpkdsfywykgvisrgwldl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoxI (I:)
    sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
    eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
    wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
    pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
    vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
    rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
    dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
    hvdydtlvrtpkdsfywykgvisrgwldl
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoxJ (J:)
    sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
    eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
    wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
    pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
    vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
    rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
    dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
    hvdydtlvrtpkdsfywykgvisrgwldl
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoxK (K:)
    sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
    eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
    wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
    pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
    vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
    rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
    dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
    hvdydtlvrtpkdsfywykgvisrgwldl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoxL (L:)
    sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
    eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
    wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
    pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
    vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
    rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
    dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
    hvdydtlvrtpkdsfywykgvisrgwldl
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoxM (M:)
    sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
    eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
    wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
    pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
    vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
    rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
    dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
    hvdydtlvrtpkdsfywykgvisrgwldl
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoxN (N:)
    sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
    eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
    wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
    pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
    vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
    rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
    dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
    hvdydtlvrtpkdsfywykgvisrgwldl
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoxO (O:)
    sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
    eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
    wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
    pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
    vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
    rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
    dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
    hvdydtlvrtpkdsfywykgvisrgwldl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoxP (P:)
    sihmfpsdfkwgvataayqiegaynedgrgmsiwdtfahtpgkvkngdngnvacdsyhrv
    eedvqllkdlgvkvyrfsiswprvlpqgtgevnragldyyhrlvdellangiepfctlyh
    wdlpqalqdqggwgsritidafaeyaelmfkelggkikqwitfnepwcmaflsnylgvha
    pgnkdlqlaidvshhllvahgravtlfrelgisgeigiapntswavpyrrtkedmeaclr
    vngwsgdwyldpiyfgeypkfmldwyenlgykppivdgdmelihqpidfiginyytssmn
    rynpgeaggmlsseaismgapktdigweiyaeglydllrytadkygnptlyitengacyn
    dglsldgrihdqrridylamhliqasraiedginlkgymewslmdnfewaegygmrfglv
    hvdydtlvrtpkdsfywykgvisrgwldl