PDB entry 1qou

View 1qou on RCSB PDB site
Description: cen (centroradialis) protein from antirrhinum
Class: plant protein
Keywords: influorescence determination in flowering plant meristem, signalling, member of the phosphatidylethanolamine binding protein family
Deposited on 1999-11-17, released 2000-03-31
The last revision prior to the SCOP 1.75 freeze date was dated 2000-03-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cen
    Species: Antirrhinum majus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qoua_
  • Chain 'B':
    Compound: cen
    Species: Antirrhinum majus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qoub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qouA (A:)
    maakvssdplvigrvigdvvdhftstvkmsviynsnnsikhvynghelfpsavtstprve
    vhggdmrsfftlimtdpdvpgpsdpylrehlhwivtdipgttdssfgkevvsyemprpni
    gihrfvfllfkqkkrgqamlsppvvcrdgfntrkftqenelglpvaavffncqretaarr
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qouA (A:)
    grvigdvvdhftstvkmsviynsikhvynghelfpsavtstprvevhggdmrsfftlimt
    dpdvpgpsdpylrehlhwivtdipgttdssfgkevvsyemprpnigihrfvfllfkqkkr
    gvvcrdgfntrkftqenelglpvaavffncqret
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qouB (B:)
    maakvssdplvigrvigdvvdhftstvkmsviynsnnsikhvynghelfpsavtstprve
    vhggdmrsfftlimtdpdvpgpsdpylrehlhwivtdipgttdssfgkevvsyemprpni
    gihrfvfllfkqkkrgqamlsppvvcrdgfntrkftqenelglpvaavffncqretaarr
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qouB (B:)
    vssdplvigrvigdvvdhftstvkmsviynssikhvynghelfpsavtstprvevhggdm
    rsfftlimtdpdvpgpsdpylrehlhwivtdipgttdssfgkevvsyemprpnigihrfv
    fllfkqkkrvvcrdgfntrkftqenelglpvaavffncqre