PDB entry 1qos

View 1qos on RCSB PDB site
Description: lectin uea-II complexed with chitobiose
Class: lectin
Keywords: lectin, carbohydrate binding, n-acetylglucosamine
Deposited on 1999-11-16, released 2000-02-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.189
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitin binding lectin, uea-II
    Species: ULEX EUROPAEUS
    Database cross-references and differences (RAF-indexed):
    • GB AAG16779
      • onflict (24)
      • onflict (61)
      • onflict (105)
      • onflict (111)
      • onflict (190)
      • onflict (228)
    Domains in SCOP 1.73: d1qosa_
  • Chain 'B':
    Compound: chitin binding lectin, uea-II
    Species: ULEX EUROPAEUS
    Database cross-references and differences (RAF-indexed):
    • GB AAG16779
      • onflict (24)
      • onflict (61)
      • onflict (105)
      • onflict (111)
      • onflict (190)
      • onflict (228)
    Domains in SCOP 1.73: d1qosb_
  • Heterogens: NAG, MN, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qosA (A:)
    nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
    sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
    qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
    ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
    nn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qosA (A:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qosB (B:)
    nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
    sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
    qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
    ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
    nn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qosB (B:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle