PDB entry 1qos

View 1qos on RCSB PDB site
Description: lectin uea-ii complexed with chitobiose
Deposited on 1999-11-16, released 2000-02-07
The last revision prior to the SCOP 1.67 freeze date was dated 2000-09-02, with a file datestamp of 2000-09-02.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.189
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1qosa_
  • Chain 'B':
    Domains in SCOP 1.67: d1qosb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qosA (A:)
    nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
    sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
    qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
    ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
    nn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qosA (A:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qosB (B:)
    nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
    sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
    qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
    ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
    nn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qosB (B:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle