PDB entry 1qor

View 1qor on RCSB PDB site
Description: crystal structure of escherichia coli quinone oxidoreductase complexed with nadph
Deposited on 1995-02-14, released 1995-06-03
The last revision prior to the SCOP 1.71 freeze date was dated 1995-06-03, with a file datestamp of 1995-06-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.14
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qorA (A:)
    matriefhkhggpevlqaveftpadpaeneiqvenkaiginfidtyirsglypppslpsg
    lgteaagivskvgsgvkhikagdrvvyaqsalgayssvhniiadkaailpaaisfeqaaa
    sflkgltvyyllrktyeikpdeqflfhaaaggvgliacqwakalgakligtvgtaqkaqs
    alkagawqvinyreedlverlkeitggkkvrvvydsvgrdtwersldclqrrglmvsfgn
    ssgavtgvnlgilnqkgslyvtrpslqgyittreelteasnelfsliasgvikvdvaeqq
    kyplkdaqraheilesratqgssllip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qorA (A:)
    atriefhkhggpevlqaveftpadpaeneiqvenkaiginfidtyirsglypppslpsgl
    gteaagivskvgsgvkhikagdrvvyaqsalgayssvhniiadkaailpaaisfeqaaas
    flkgltvyyllrktyeikpdeqflfhaaaggvgliacqwakalgakligtvgtaqkaqsa
    lkagawqvinyreedlverlkeitggkkvrvvydsvgrdtwersldclqrrglmvsfgns
    sgavtgvnlgilnqkgslyvtrpslqgyittreelteasnelfsliasgvikvdvaeqqk
    yplkdaqraheilesratqgssllip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qorB (B:)
    matriefhkhggpevlqaveftpadpaeneiqvenkaiginfidtyirsglypppslpsg
    lgteaagivskvgsgvkhikagdrvvyaqsalgayssvhniiadkaailpaaisfeqaaa
    sflkgltvyyllrktyeikpdeqflfhaaaggvgliacqwakalgakligtvgtaqkaqs
    alkagawqvinyreedlverlkeitggkkvrvvydsvgrdtwersldclqrrglmvsfgn
    ssgavtgvnlgilnqkgslyvtrpslqgyittreelteasnelfsliasgvikvdvaeqq
    kyplkdaqraheilesratqgssllip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qorB (B:)
    atriefhkhggpevlqaveftpadpaeneiqvenkaiginfidtyirsglypppslpsgl
    gteaagivskvgsgvkhikagdrvvyaqsalgayssvhniiadkaailpaaisfeqaaas
    flkgltvyyllrktyeikpdeqflfhaaaggvgliacqwakalgakligtvgtaqkaqsa
    lkagawqvinyreedlverlkeitggkkvrvvydsvgrdtwersldclqrrglmvsfgns
    sgavtgvnlgilnqkgslyvtrpslqgyittreelteasnelfsliasgvikvdvaeqqk
    yplkdaqraheilesratqgssllip