PDB entry 1qoo

View 1qoo on RCSB PDB site
Description: lectin uea-ii complexed with nag
Deposited on 1999-11-15, released 1999-11-23
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-02, with a file datestamp of 2000-09-02.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.174
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qooa_
  • Chain 'B':
    Domains in SCOP 1.55: d1qoob_
  • Chain 'C':
    Domains in SCOP 1.55: d1qooc_
  • Chain 'D':
    Domains in SCOP 1.55: d1qood_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qooA (A:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qooA (A:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvstttsigralyaapiqiwdsitg
    kvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqiia
    vefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptksltvc
    lsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qooB (B:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qooC (C:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qooD (D:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle