PDB entry 1qok

View 1qok on RCSB PDB site
Description: mfe-23 an anti-carcinoembryonic antigen single-chain fv antibody
Class: immunoglobulin
Keywords: immunoglobulin, single-chain fv, anti-carcinoembryonic antigen
Deposited on 1999-11-11, released 2000-11-10
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mfe-23 recombinant antibody fragment
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1qoka1, d1qoka2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qokA (A:)
    etvimkyllptaaagllllaaqpamaqvklqqsgaelvrsgtsvklsctasgfnikdsym
    hwlrqgpeqglewigwidpengdteyapkfqgkatfttdtssntaylqlssltsedtavy
    ycnegtptgpyyfdywgqgttvtvssggggsggggsggggsenvltqspaimsaspgekv
    titcsasssvsymhwfqqkpgtspklwiystsnlasgvparfsgsgsgtsysltisrmea
    edaatyycqqrssypltfgagtklelkraaaeqkliseedln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qokA (A:)
    qvklqqsgaelvrsgtsvklsctasgfnikdsymhwlrqgpeqglewigwidpengdtey
    apkfqgkatfttdtssntaylqlssltsedtavyycnegtptgpyyfdywgqgttvtvss
    genvltqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklwiystsnlasgvpa
    rfsgsgsgtsysltisrmeaedaatyycqqrssypltfgagtklelk