PDB entry 1qoj

View 1qoj on RCSB PDB site
Description: crystal structure of e.coli uvrb c-terminal domain, and a model for uvrb-uvrc interaction.
Class: DNA excision repair
Keywords: DNA excision repair, nucleotide excision repair, x-ray crystallography, uvrb protein, uvrb-c interaction
Deposited on 1999-11-10, released 2000-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.3266
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uvrb
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QOJ
      • modified residue (32-33)
    • Uniprot P07025 (Start-62)
    Domains in SCOPe 2.07: d1qoja_
  • Chain 'B':
    Compound: uvrb
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QOJ
      • modified residue (32-33)
      • modified residue (16)
    • Uniprot P07025 (Start-62)
    Domains in SCOPe 2.07: d1qojb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qojA (A:)
    mhhhhhhlepdnvpmdmspkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfi
    aas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qojA (A:)
    spkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfiaas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qojB (B:)
    mhhhhhhlepdnvpmdmspkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfi
    aas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qojB (B:)
    mspkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfiaas