PDB entry 1qoj

View 1qoj on RCSB PDB site
Description: crystal structure of e.coli uvrb c-terminal domain, and a model for uvrb-uvrc interaction.
Deposited on 1999-11-10, released 2000-11-10
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-10, with a file datestamp of 2000-11-10.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.3266
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qoja_
  • Chain 'B':
    Domains in SCOP 1.55: d1qojb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qojA (A:)
    spkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfiaas
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qojB (B:)
    mspkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfiaas