PDB entry 1qog
View 1qog on RCSB PDB site
Description: ferredoxin mutation s47a
Class: electron transport
Keywords: electron transport, iron-sulfur, ferredoxin
Deposited on
1997-08-14, released
1998-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ferredoxin
Species: Nostoc sp. [TaxId:103690]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1qoga_ - Chain 'B':
Compound: ferredoxin
Species: Nostoc sp. [TaxId:103690]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1qogb_ - Heterogens: SO4, FES, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1qogA (A:)
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacatcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1qogB (B:)
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacatcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly