PDB entry 1qob

View 1qob on RCSB PDB site
Description: ferredoxin mutation d62k
Deposited on 1997-08-14, released 1998-01-14
The last revision prior to the SCOP 1.65 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1qoba_
  • Chain 'B':
    Domains in SCOP 1.65: d1qobb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qobA (A:)
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
skqsfldddqieagyvltcvayptsdvviqthkeedly

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qobB (B:)
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
skqsfldddqieagyvltcvayptsdvviqthkeedly