PDB entry 1qoa

View 1qoa on RCSB PDB site
Description: ferredoxin mutation c49s
Deposited on 1997-08-14, released 1998-01-14
The last revision prior to the SCOP 1.63 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1qoaa_
  • Chain 'B':
    Domains in SCOP 1.63: d1qoab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoaA (A:)
    atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstsagklvsgtvdq
    sdqsfldddqieagyvltcvayptsdvviqthkeedly
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qoaB (B:)
    atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstsagklvsgtvdq
    sdqsfldddqieagyvltcvayptsdvviqthkeedly