PDB entry 1qo6

View 1qo6 on RCSB PDB site
Description: solution structure of a pair of modules from the gelatin-binding domain of fibronectin
Deposited on 1999-11-04, released 2000-01-11
The last revision prior to the SCOP 1.69 freeze date was dated 2000-01-11, with a file datestamp of 2000-01-10.
Experiment type: NMR55
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qo6A (A:)
yghcvtdsgvvysvgmqwlktqgnkqmlctclgngvscqetavtqtyggnsngepcvlpf
tyngrtfyscttegrqdghlwcsttsnyeqdqkysfctdht