PDB entry 1qnw

View 1qnw on RCSB PDB site
Description: lectin II from ulex europaeus
Class: lectin
Keywords: lectin, carbohydrate binding
Deposited on 1999-10-22, released 1999-11-23
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.178
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitin binding lectin, uea-II
    Species: Ulex europeus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22973
      • onflict (24)
      • onflict (61)
      • onflict (105)
      • onflict (111)
      • onflict (190)
      • onflict (228)
    Domains in SCOP 1.73: d1qnwa_
  • Chain 'B':
    Compound: chitin binding lectin, uea-II
    Species: Ulex europeus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22973
      • onflict (24)
      • onflict (61)
      • onflict (105)
      • onflict (111)
      • onflict (190)
      • onflict (228)
    Domains in SCOP 1.73: d1qnwb_
  • Chain 'C':
    Compound: chitin binding lectin, uea-II
    Species: Ulex europeus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22973
      • onflict (24)
      • onflict (61)
      • onflict (105)
      • onflict (111)
      • onflict (190)
      • onflict (228)
    Domains in SCOP 1.73: d1qnwc_
  • Chain 'D':
    Compound: chitin binding lectin, uea-II
    Species: Ulex europeus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22973
      • onflict (24)
      • onflict (61)
      • onflict (105)
      • onflict (111)
      • onflict (190)
      • onflict (228)
    Domains in SCOP 1.73: d1qnwd_
  • Heterogens: NAG, MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qnwA (A:)
    nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
    sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
    qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
    ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
    nn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qnwA (A:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvstttsigralyaapiqiwdsitg
    kvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqiia
    vefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptksltvc
    lsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qnwB (B:)
    nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
    sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
    qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
    ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
    nn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qnwB (B:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qnwC (C:)
    nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
    sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
    qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
    ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
    nn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qnwC (C:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qnwD (D:)
    nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
    sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
    qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
    ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
    nn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qnwD (D:)
    sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
    tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
    iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
    vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle