PDB entry 1qnv

View 1qnv on RCSB PDB site
Description: yeast 5-aminolaevulinic acid dehydratase lead (pb) complex
Deposited on 1999-10-21, released 2000-10-19
The last revision prior to the SCOP 1.65 freeze date was dated 2000-10-19, with a file datestamp of 2000-10-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.252
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1qnva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qnvA (A:)
    mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
    pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
    eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
    midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa
    grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa
    ekgvvdlktiafeshqgflragarliitylapefldwldeen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qnvA (A:)
    mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
    pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
    eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
    midgrirdikrglinanlahktfvlsyaakfsgnlygpfcyqlppagrglarralerdms
    egadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaaekgvvdlktiafes
    hqgflragarliitylapefldwldeen