PDB entry 1qnu

View 1qnu on RCSB PDB site
Description: shiga-like toxin I b subunit complexed with the bridged-starfish inhibitor
Class: toxin
Keywords: toxin, subnanomolar inhibitor, multivalent protein-carbohydrate recognition, ob-fold
Deposited on 1999-10-21, released 2000-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.25
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: shiga-like toxin I b subunit
  Species: Phage h30 [TaxId:12371]
  Database cross-references and differences (RAF-indexed):
  • Uniprot AAA71894
  Domains in SCOPe 2.07: d1qnua_
• Chain 'B':
  Compound: shiga-like toxin I b subunit
  Species: Phage h30 [TaxId:12371]
  Database cross-references and differences (RAF-indexed):
  • Uniprot AAA71894
  Domains in SCOPe 2.07: d1qnub_
• Chain 'C':
  Compound: shiga-like toxin I b subunit
  Species: Phage h30 [TaxId:12371]
  Database cross-references and differences (RAF-indexed):
  • Uniprot AAA71894
  Domains in SCOPe 2.07: d1qnuc_
• Chain 'D':
  Compound: shiga-like toxin I b subunit
  Species: Phage h30 [TaxId:12371]
  Database cross-references and differences (RAF-indexed):
  • Uniprot AAA71894
  Domains in SCOPe 2.07: d1qnud_
• Chain 'E':
  Compound: shiga-like toxin I b subunit
  Species: Phage h30 [TaxId:12371]
  Database cross-references and differences (RAF-indexed):
  • Uniprot AAA71894 (0-68)
  Domains in SCOPe 2.07: d1qnue_
• Heterogens: EMB, MEC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qnuA (A:)
  tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
  ggfsevifr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qnuB (B:)
  tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
  ggfsevifr
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qnuC (C:)
  tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
  ggfsevifr
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qnuD (D:)
  tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
  ggfsevifr
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qnuE (E:)
  tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
  ggfsevifr