PDB entry 1qnu

View 1qnu on RCSB PDB site
Description: Shiga-Like Toxin I B Subunit Complexed with the Bridged-Starfish Inhibitor
Class: toxin
Keywords: toxin, subnanomolar inhibitor, multivalent protein-carbohydrate recognition, ob-fold
Deposited on 1999-10-21, released 2000-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shiga toxin 1 variant B subunit
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: stx1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qnua_
  • Chain 'B':
    Compound: Shiga toxin 1 variant B subunit
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: stx1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qnub_
  • Chain 'C':
    Compound: Shiga toxin 1 variant B subunit
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: stx1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qnuc_
  • Chain 'D':
    Compound: Shiga toxin 1 variant B subunit
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: stx1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qnud_
  • Chain 'E':
    Compound: Shiga toxin 1 variant B subunit
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: stx1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qnue_
  • Heterogens: EMB, MEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qnuA (A:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qnuB (B:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qnuC (C:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qnuD (D:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qnuE (E:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr