PDB entry 1qnu
View 1qnu on RCSB PDB site
Description: Shiga-Like Toxin I B Subunit Complexed with the Bridged-Starfish Inhibitor
Class: toxin
Keywords: toxin, subnanomolar inhibitor, multivalent protein-carbohydrate recognition, ob-fold
Deposited on
1999-10-21, released
2000-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated
2020-07-29, with a file datestamp of
2020-06-29.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.35
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Shiga toxin 1 variant B subunit
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: stx1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1qnua_ - Chain 'B':
Compound: Shiga toxin 1 variant B subunit
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: stx1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1qnub_ - Chain 'C':
Compound: Shiga toxin 1 variant B subunit
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: stx1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1qnuc_ - Chain 'D':
Compound: Shiga toxin 1 variant B subunit
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: stx1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1qnud_ - Chain 'E':
Compound: Shiga toxin 1 variant B subunit
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: stx1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1qnue_ - Heterogens: EMB, MEC, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1qnuA (A:)
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1qnuB (B:)
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1qnuC (C:)
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1qnuD (D:)
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>1qnuE (E:)
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr