PDB entry 1qnn

View 1qnn on RCSB PDB site
Description: cambialistic superoxide dismutase from porphyromonas gingivalis
Deposited on 1999-10-20, released 2000-06-21
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-21, with a file datestamp of 2000-06-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qnnA (A:)
    mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
    eggifnnagqtlnhnlyftqfrpgkggapkgklgeaidkqfgsfekfkeefntagttlfg
    sgwvwlasdangklsiekepnagnpvrkglnpllgfdvwehayyltyqnrradhlkdlws
    ivdwdivesry
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qnnB (B:)
    mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
    eggifnnagqtlnhnlyftqfrpgkggapkgklgeaidkqfgsfekfkeefntagttlfg
    sgwvwlasdangklsiekepnagnpvrkglnpllgfdvwehayyltyqnrradhlkdlws
    ivdwdivesry
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qnnC (C:)
    mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
    eggifnnagqtlnhnlyftqfrpgkggapkgklgeaidkqfgsfekfkeefntagttlfg
    sgwvwlasdangklsiekepnagnpvrkglnpllgfdvwehayyltyqnrradhlkdlws
    ivdwdivesry
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qnnD (D:)
    thelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqkse
    ggifnnagqtlnhnlyftqfrpgkggapkgklgeaidkqfgsfekfkeefntagttlfgs
    gwvwlasdangklsiekepnagnpvrkglnpllgfdvwehayyltyqnrradhlkdlwsi
    vdwdivesry