PDB entry 1qnn

View 1qnn on RCSB PDB site
Description: Cambialistic superoxide dismutase from Porphyromonas gingivalis
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1999-10-20, released 2000-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Porphyromonas gingivalis [TaxId:837]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qnna1, d1qnna2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Porphyromonas gingivalis [TaxId:837]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qnnb1, d1qnnb2
  • Chain 'C':
    Compound: superoxide dismutase
    Species: Porphyromonas gingivalis [TaxId:837]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qnnc1, d1qnnc2
  • Chain 'D':
    Compound: superoxide dismutase
    Species: Porphyromonas gingivalis [TaxId:837]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qnnd1, d1qnnd2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qnnA (A:)
    mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
    eggifnnagqtlnhnlyftqfrpgkggapkgklgeaidkqfgsfekfkeefntagttlfg
    sgwvwlasdangklsiekepnagnpvrkglnpllgfdvwehayyltyqnrradhlkdlws
    ivdwdivesry
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qnnB (B:)
    mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
    eggifnnagqtlnhnlyftqfrpgkggapkgklgeaidkqfgsfekfkeefntagttlfg
    sgwvwlasdangklsiekepnagnpvrkglnpllgfdvwehayyltyqnrradhlkdlws
    ivdwdivesry
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qnnC (C:)
    mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
    eggifnnagqtlnhnlyftqfrpgkggapkgklgeaidkqfgsfekfkeefntagttlfg
    sgwvwlasdangklsiekepnagnpvrkglnpllgfdvwehayyltyqnrradhlkdlws
    ivdwdivesry
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qnnD (D:)
    mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
    eggifnnagqtlnhnlyftqfrpgkggapkgklgeaidkqfgsfekfkeefntagttlfg
    sgwvwlasdangklsiekepnagnpvrkglnpllgfdvwehayyltyqnrradhlkdlws
    ivdwdivesry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qnnD (D:)
    thelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqkse
    ggifnnagqtlnhnlyftqfrpgkggapkgklgeaidkqfgsfekfkeefntagttlfgs
    gwvwlasdangklsiekepnagnpvrkglnpllgfdvwehayyltyqnrradhlkdlwsi
    vdwdivesry