PDB entry 1qnm

View 1qnm on RCSB PDB site
Description: human manganese superoxide dismutase mutant q143n
Class: oxidoreductase
Keywords: oxidoreductase, manganese superoxide dismutase, hmnsod
Deposited on 1997-07-03, released 1998-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: MUTATED RECOMBINANT HUMAN GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (142)
    Domains in SCOPe 2.07: d1qnma1, d1qnma2
  • Chain 'B':
    Compound: manganese superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: MUTATED RECOMBINANT HUMAN GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (142)
    Domains in SCOPe 2.07: d1qnmb1, d1qnmb2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qnmA (A:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnndplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qnmB (B:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnndplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk