PDB entry 1qnj

View 1qnj on RCSB PDB site
Description: the structure of native porcine pancreatic elastase at atomic resolution (1.1 a)
Class: hydrolase (serine protease)
Keywords: hydrolase(serine protease), atomic resolution
Deposited on 1999-10-15, released 2000-03-31
The last revision prior to the SCOP 1.73 freeze date was dated 2000-04-25, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.1267
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elastase
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qnja_
  • Heterogens: NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qnjA (A:)
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn