PDB entry 1qni

View 1qni on RCSB PDB site
Description: crystal structure of nitrous oxide reductase from pseudomonas nautica, at 2.4a resolution
Deposited on 1999-10-15, released 2000-10-13
The last revision prior to the SCOP 1.63 freeze date was dated 2001-02-26, with a file datestamp of 2001-02-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2277
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qniA (A:)
    ahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgitneskeilgg
    dqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkithipnvqaihg
    lrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawqvivdgnldn
    tdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnfktigdskvp
    vvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidklddlfedkiel
    rdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdrvnyirqkld
    vqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidisgeemklvhd
    gptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkvirdgnkvrv
    ymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeispqqtasvtf
    tagkpgvywyycnwfchalhmemvgrmlveaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qniB (B:)
    ahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgitneskeilgg
    dqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkithipnvqaihg
    lrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawqvivdgnldn
    tdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnfktigdskvp
    vvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidklddlfedkiel
    rdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdrvnyirqkld
    vqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidisgeemklvhd
    gptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkvirdgnkvrv
    ymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeispqqtasvtf
    tagkpgvywyycnwfchalhmemvgrmlveaa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qniC (C:)
    ahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgitneskeilgg
    dqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkithipnvqaihg
    lrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawqvivdgnldn
    tdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnfktigdskvp
    vvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidklddlfedkiel
    rdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdrvnyirqkld
    vqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidisgeemklvhd
    gptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkvirdgnkvrv
    ymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeispqqtasvtf
    tagkpgvywyycnwfchalhmemvgrmlveaa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qniD (D:)
    ahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgitneskeilgg
    dqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkithipnvqaihg
    lrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawqvivdgnldn
    tdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnfktigdskvp
    vvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidklddlfedkiel
    rdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdrvnyirqkld
    vqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidisgeemklvhd
    gptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkvirdgnkvrv
    ymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeispqqtasvtf
    tagkpgvywyycnwfchalhmemvgrmlveaa
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qniE (E:)
    ahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgitneskeilgg
    dqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkithipnvqaihg
    lrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawqvivdgnldn
    tdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnfktigdskvp
    vvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidklddlfedkiel
    rdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdrvnyirqkld
    vqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidisgeemklvhd
    gptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkvirdgnkvrv
    ymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeispqqtasvtf
    tagkpgvywyycnwfchalhmemvgrmlveaa
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qniF (F:)
    ahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgitneskeilgg
    dqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkithipnvqaihg
    lrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawqvivdgnldn
    tdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnfktigdskvp
    vvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidklddlfedkiel
    rdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdrvnyirqkld
    vqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidisgeemklvhd
    gptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkvirdgnkvrv
    ymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeispqqtasvtf
    tagkpgvywyycnwfchalhmemvgrmlveaa