PDB entry 1qni

View 1qni on RCSB PDB site
Description: Crystal Structure of Nitrous Oxide Reductase from Pseudomonas nautica, at 2.4A Resolution
Class: oxidoreductase
Keywords: oxidoreductase, denitrification, mad, electron transfer
Deposited on 1999-10-15, released 2000-10-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrous-oxide reductase
    Species: PSEUDOMONAS NAUTICA [TaxId:2743]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QNI (Start-580)
    Domains in SCOPe 2.08: d1qnia1, d1qnia2
  • Chain 'B':
    Compound: nitrous-oxide reductase
    Species: PSEUDOMONAS NAUTICA [TaxId:2743]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QNI (Start-580)
    Domains in SCOPe 2.08: d1qnib1, d1qnib2
  • Chain 'C':
    Compound: nitrous-oxide reductase
    Species: PSEUDOMONAS NAUTICA [TaxId:2743]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QNI (Start-580)
    Domains in SCOPe 2.08: d1qnic1, d1qnic2
  • Chain 'D':
    Compound: nitrous-oxide reductase
    Species: PSEUDOMONAS NAUTICA [TaxId:2743]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QNI (Start-580)
    Domains in SCOPe 2.08: d1qnid1, d1qnid2
  • Chain 'E':
    Compound: nitrous-oxide reductase
    Species: PSEUDOMONAS NAUTICA [TaxId:2743]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QNI (Start-580)
    Domains in SCOPe 2.08: d1qnie1, d1qnie2
  • Chain 'F':
    Compound: nitrous-oxide reductase
    Species: PSEUDOMONAS NAUTICA [TaxId:2743]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QNI (Start-580)
    Domains in SCOPe 2.08: d1qnif1, d1qnif2
  • Heterogens: CUA, CUZ, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qniA (A:)
    aaaeearnkahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgit
    neskeilggdqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkith
    ipnvqaihglrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawq
    vivdgnldntdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnf
    ktigdskvpvvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidkld
    dlfedkielrdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdr
    vnyirqkldvqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidis
    geemklvhdgptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkv
    irdgnkvrvymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeis
    pqqtasvtftagkpgvywyycnwfchalhmemvgrmlveaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qniA (A:)
    ahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgitneskeilgg
    dqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkithipnvqaihg
    lrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawqvivdgnldn
    tdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnfktigdskvp
    vvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidklddlfedkiel
    rdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdrvnyirqkld
    vqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidisgeemklvhd
    gptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkvirdgnkvrv
    ymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeispqqtasvtf
    tagkpgvywyycnwfchalhmemvgrmlveaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qniB (B:)
    aaaeearnkahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgit
    neskeilggdqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkith
    ipnvqaihglrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawq
    vivdgnldntdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnf
    ktigdskvpvvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidkld
    dlfedkielrdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdr
    vnyirqkldvqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidis
    geemklvhdgptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkv
    irdgnkvrvymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeis
    pqqtasvtftagkpgvywyycnwfchalhmemvgrmlveaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qniB (B:)
    ahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgitneskeilgg
    dqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkithipnvqaihg
    lrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawqvivdgnldn
    tdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnfktigdskvp
    vvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidklddlfedkiel
    rdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdrvnyirqkld
    vqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidisgeemklvhd
    gptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkvirdgnkvrv
    ymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeispqqtasvtf
    tagkpgvywyycnwfchalhmemvgrmlveaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qniC (C:)
    aaaeearnkahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgit
    neskeilggdqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkith
    ipnvqaihglrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawq
    vivdgnldntdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnf
    ktigdskvpvvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidkld
    dlfedkielrdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdr
    vnyirqkldvqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidis
    geemklvhdgptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkv
    irdgnkvrvymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeis
    pqqtasvtftagkpgvywyycnwfchalhmemvgrmlveaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qniC (C:)
    ahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgitneskeilgg
    dqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkithipnvqaihg
    lrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawqvivdgnldn
    tdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnfktigdskvp
    vvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidklddlfedkiel
    rdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdrvnyirqkld
    vqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidisgeemklvhd
    gptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkvirdgnkvrv
    ymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeispqqtasvtf
    tagkpgvywyycnwfchalhmemvgrmlveaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qniD (D:)
    aaaeearnkahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgit
    neskeilggdqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkith
    ipnvqaihglrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawq
    vivdgnldntdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnf
    ktigdskvpvvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidkld
    dlfedkielrdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdr
    vnyirqkldvqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidis
    geemklvhdgptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkv
    irdgnkvrvymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeis
    pqqtasvtftagkpgvywyycnwfchalhmemvgrmlveaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qniD (D:)
    ahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgitneskeilgg
    dqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkithipnvqaihg
    lrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawqvivdgnldn
    tdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnfktigdskvp
    vvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidklddlfedkiel
    rdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdrvnyirqkld
    vqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidisgeemklvhd
    gptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkvirdgnkvrv
    ymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeispqqtasvtf
    tagkpgvywyycnwfchalhmemvgrmlveaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qniE (E:)
    aaaeearnkahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgit
    neskeilggdqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkith
    ipnvqaihglrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawq
    vivdgnldntdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnf
    ktigdskvpvvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidkld
    dlfedkielrdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdr
    vnyirqkldvqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidis
    geemklvhdgptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkv
    irdgnkvrvymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeis
    pqqtasvtftagkpgvywyycnwfchalhmemvgrmlveaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qniE (E:)
    ahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgitneskeilgg
    dqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkithipnvqaihg
    lrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawqvivdgnldn
    tdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnfktigdskvp
    vvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidklddlfedkiel
    rdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdrvnyirqkld
    vqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidisgeemklvhd
    gptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkvirdgnkvrv
    ymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeispqqtasvtf
    tagkpgvywyycnwfchalhmemvgrmlveaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1qniF (F:)
    aaaeearnkahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgit
    neskeilggdqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkith
    ipnvqaihglrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawq
    vivdgnldntdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnf
    ktigdskvpvvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidkld
    dlfedkielrdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdr
    vnyirqkldvqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidis
    geemklvhdgptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkv
    irdgnkvrvymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeis
    pqqtasvtftagkpgvywyycnwfchalhmemvgrmlveaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qniF (F:)
    ahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgitneskeilgg
    dqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkithipnvqaihg
    lrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawqvivdgnldn
    tdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnfktigdskvp
    vvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidklddlfedkiel
    rdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdrvnyirqkld
    vqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidisgeemklvhd
    gptyaephdcilvrrdqiktkkiyerndpyfascraqaekdgvtlesdnkvirdgnkvrv
    ymtsvapqygmtdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeispqqtasvtf
    tagkpgvywyycnwfchalhmemvgrmlveaa