PDB entry 1qnf

View 1qnf on RCSB PDB site
Description: structure of photolyase
Class: DNA repair
Keywords: DNA repair, electron transfer, excitation energy transfer, lyase (carbon-carbon)
Deposited on 1997-07-04, released 1998-01-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: photolyase
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qnfa1, d1qnfa2
  • Heterogens: FAD, HDF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qnfA (A:)
    maapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclq
    elqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalkta
    giravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlt
    aiaplllselptlkqlgfdwdggfpvepgetaaiarlqefcdraiadydpqrnfpaeagt
    sglspalkfgaigirqawqaasaahalsrsdearnsirvwqqelawrefyqhalyhfpsl
    adgpyrslwqqfpwenrealftawtqaqtgypivdaamrqltetgwmhnrcrmivasflt
    kdliidwrrgeqffmqhlvdgdlaannggwqwsassgmdpkplrifnpasqakkfdatat
    yikrwlpelrhvhpkdlisgeitpierrgypapivnhnlrqkqfkalynqlkaaiaepea
    epds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qnfA (A:)
    maapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclq
    elqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalkta
    giravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlt
    aiaplllselptlkqlgfdwdggfpvepgetaaiarlqefcdraiadydpqrnfpaeagt
    sglspalkfgaigirqawqaasaahalsrsdearnsirvwqqelawrefyqhalyhfpsl
    adgpyrslwqqfpwenrealftawtqaqtgypivdaamrqltetgwmhnrcrmivasflt
    kdliidwrrgeqffmqhlvdgdlaannggwqwsassgmdpkplrifnpasqakkfdatat
    yikrwlpelrhvhpkdlisgeitpierrgypapivnhnlrqkqfkalynqlkaai