PDB entry 1qnd

View 1qnd on RCSB PDB site
Description: sterol carrier protein-2, nmr, 20 structures
Class: transfer protein
Keywords: transfer protein, sterol carrier protein 2, protein structure, protein dynamics, nitroxide spin labels, lipid binding
Deposited on 1999-10-14, released 2000-07-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nonspecific lipid-transfer protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qnda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qndA (A:)
    ssasdgfkanlvfkeiekkleeegeqfvkkiggifafkvkdgpggkeatwvvdvkngkgs
    vlpnsdkkadctitmadsdflalmtgkmnpqsaffqgklkitgnmglamklqnlqlqpgn
    akl