PDB entry 1qnd

View 1qnd on RCSB PDB site
Description: sterol carrier protein-2, nmr, 20 structures
Deposited on 1999-10-14, released 2000-07-03
The last revision prior to the SCOP 1.69 freeze date was dated 2002-02-28, with a file datestamp of 2002-02-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1qnda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qndA (A:)
    ssasdgfkanlvfkeiekkleeegeqfvkkiggifafkvkdgpggkeatwvvdvkngkgs
    vlpnsdkkadctitmadsdflalmtgkmnpqsaffqgklkitgnmglamklqnlqlqpgn
    akl