PDB entry 1qnc

View 1qnc on RCSB PDB site
Description: Crystal structure of the A(-31) Adenovirus major late promoter TATA box variant bound to wild-type TBP (Arabidopsis thaliana TBP isoform 2). TATA element recognition by the TATA box-binding protein has been conserved throughout evolution.
Class: tata box-binding protein (tbp)
Keywords: tata box-binding protein (tbp), adenovirus major late promoter (admlp) tata box, tbp-tata element complexes, a (- 31) tata box variant
Deposited on 1999-10-14, released 2000-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription initiation factor tfiid-1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qnca1, d1qnca2
  • Chain 'B':
    Compound: transcription initiation factor tfiid-1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qncb1, d1qncb2
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*ap*ap*tp*ap*ap*ap*ap*gp*gp*gp*cp*a)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*gp*cp*cp*cp*tp*tp*tp*tp*ap*tp*tp*gp*c)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*gp*cp*ap*ap*tp*ap*ap*ap*ap*gp*gp*gp*cp*a)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*tp*gp*cp*cp*cp*tp*tp*tp*tp*ap*tp*tp*gp*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qncA (A:)
    mtdqglegsnpvdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaav
    imrirepkttalifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivg
    scdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrde
    tykafeniypvlsefrkiqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qncA (A:)
    khpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepkttalifa
    sgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirleglay
    shaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniypvlsef
    rki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qncB (B:)
    mtdqglegsnpvdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaav
    imrirepkttalifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivg
    scdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrde
    tykafeniypvlsefrkiqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qncB (B:)
    vdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktta
    lifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirle
    glayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniypv
    lsefrki
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.