PDB entry 1qna

View 1qna on RCSB PDB site
Description: crystal structure of the t(-30) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Class: tata box-binding protein (tbp)
Keywords: tata box-binding protein (tbp), adenovirus major late promoter (admlp) tata box, tbp-tata element complex, t(-30) tata box variant
Deposited on 1999-10-14, released 2000-02-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription initiation factor tfiid-1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1qnaa1, d1qnaa2
  • Chain 'B':
    Compound: transcription initiation factor tfiid-1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1qnab1, d1qnab2
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*tp*tp*tp*ap*ap*ap*ap*gp*gp*gp*cp*a)-3')
    Species:
    Gene:
  • Chain 'D':
    Compound: DNA (5'-d(*tp*gp*cp*cp*cp*tp*tp*tp*tp*ap*ap*ap*gp*c)-3')
    Species:
    Gene:
  • Chain 'E':
    Compound: DNA (5'-d(*gp*cp*tp*tp*tp*ap*ap*ap*ap*gp*gp*gp*cp*a)-3')
    Species:
    Gene:
  • Chain 'F':
    Compound: DNA (5'-d(*tp*gp*cp*cp*cp*tp*tp*tp*tp*ap*ap*ap*gp*c)-3')
    Species:
    Gene:
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qnaA (A:)
    mtdqglegsnpvdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaav
    imrirepkttalifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivg
    scdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrde
    tykafeniypvlsefrkiqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qnaA (A:)
    hpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepkttalifas
    gkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirleglays
    haafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniypvlsefr
    ki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qnaB (B:)
    mtdqglegsnpvdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaav
    imrirepkttalifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivg
    scdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrde
    tykafeniypvlsefrkiqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qnaB (B:)
    vdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktta
    lifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirle
    glayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniypv
    lsefrk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.