PDB entry 1qn5

View 1qn5 on RCSB PDB site
Description: crystal structure of the g(-26) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Deposited on 1999-10-14, released 2000-02-01
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-07, with a file datestamp of 2000-02-07.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qn5A (A:)
    khpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepkttalifa
    sgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirleglay
    shaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniypvlsef
    rki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qn5B (B:)
    vdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktta
    lifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirle
    glayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniypv
    lsefrk