PDB entry 1qn4

View 1qn4 on RCSB PDB site
Description: crystal structure of the t(-24) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Class: tata box-binding protein (tbp)
Keywords: tata box-binding protein (tbp), adenovirus major late promoter (admlp) tata box, tbp-tata element complex, t(-24) tata box variant
Deposited on 1999-10-14, released 2000-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription initiation factor tfiid-1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qn4a1, d1qn4a2
  • Chain 'B':
    Compound: transcription initiation factor tfiid-1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qn4b1, d1qn4b2
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*tp*ap*tp*ap*ap*ap*ap*tp*gp*gp*cp*a)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*gp*cp*cp*ap*tp*tp*tp*tp*ap*tp*ap*gp*c)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*gp*cp*tp*ap*tp*ap*ap*ap*ap*tp*gp*gp*cp*a)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*tp*gp*cp*cp*ap*tp*tp*tp*tp*ap*tp*ap*gp*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qn4A (A:)
    mtdqglegsnpvdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaav
    imrirepkttalifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivg
    scdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrde
    tykafeniypvlsefrkiqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qn4A (A:)
    khpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepkttalifa
    sgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirleglay
    shaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniypvlsef
    rki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qn4B (B:)
    mtdqglegsnpvdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaav
    imrirepkttalifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivg
    scdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrde
    tykafeniypvlsefrkiqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qn4B (B:)
    vdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktta
    lifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirle
    glayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniypv
    lsefrki
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.